PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_00587
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HD-ZIP
Protein Properties Length: 741aa    MW: 80901.1 Da    PI: 5.8357
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_00587genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.9e-2164119156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++ +++t++q++eLe+lF+++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
  PEQU_00587  64 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLRLETRQVKFWFQNRRTQMK 119
                 688999***********************************************999 PP

2START187.56.8e-592664921206
                 HHHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS...........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
       START   1 elaeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv..........dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                 ela++a++elvk+a+ +ep+W+    +eng evl +++ + +          + +ea r++++v+ ++  lve+l+d + +W  +++    + +t++ i
  PEQU_00587 266 ELALSAMDELVKMAEMGEPLWMVGG-EENGREVLNIEQYELFprcvgvkssdFVSEATRMTAMVIINSLALVETLMDAA-RWADMFPgmiaRTTTTDII 362
                 57899****************9877.9**********776669********99**************************.******************* PP

                 CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--...-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
       START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                 s+g      g lqlm ae+q+lsplvp R++ f+R+++ql  g w++vdvS+d  ++ ++  s  +v++++lpSg+++++++ng+skvtwveh++++++
  PEQU_00587 363 STGvgstrnGSLQLMHAEFQVLSPLVPiREVNFLRFCKQLVNGAWAVVDVSIDGIREHNSstSGLGVKCRRLPSGCVVQDMPNGYSKVTWVEHAEYDES 461
                 *****************************************************8777666566678********************************* PP

                 XXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 176 lphwllrslvksglaegaktwvatlqrqcek 206
                  +h+l+r+l++sg+a ga++wvatlqrqce+
  PEQU_00587 462 AVHQLYRPLLRSGMALGAQRWVATLQRQCEC 492
                 *****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-2051121IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-2157123IPR009057Homeodomain-like
PROSITE profilePS5007117.84861121IPR001356Homeobox domain
SMARTSM003891.1E-1862125IPR001356Homeobox domain
PfamPF000462.7E-1864119IPR001356Homeobox domain
CDDcd000863.30E-1964122No hitNo description
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PROSITE profilePS5084842.27257495IPR002913START domain
SuperFamilySSF559612.3E-30259492No hitNo description
CDDcd088751.62E-113261491No hitNo description
SMARTSM002343.2E-41266492IPR002913START domain
PfamPF018524.3E-51266492IPR002913START domain
SuperFamilySSF559613.92E-21513719No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
QSNLEGKGEL SRLSVVASAG DGHGGGELDV LCRNKDEENE SRSGSDNLEG GSGDDLDLEN  60
PRKKKRYHRH TPQQIQELES LFKECPHPDE KQRLELSKRL RLETRQVKFW FQNRRTQMKT  120
QMERHENTIL RQENDKLRAE NISIRDAMRN AICNNCGGAA VLGDVSLEEQ HLRIENARLK  180
DELDRVCALA SKFLGRPISP AVPSSSLELA VGCNGGFSGF GSITTTFPAV SDFISGGGSN  240
SLGTVITPSR SVAVGDRSVE RSMFLELALS AMDELVKMAE MGEPLWMVGG EENGREVLNI  300
EQYELFPRCV GVKSSDFVSE ATRMTAMVII NSLALVETLM DAARWADMFP GMIARTTTTD  360
IISTGVGSTR NGSLQLMHAE FQVLSPLVPI REVNFLRFCK QLVNGAWAVV DVSIDGIREH  420
NSSTSGLGVK CRRLPSGCVV QDMPNGYSKV TWVEHAEYDE SAVHQLYRPL LRSGMALGAQ  480
RWVATLQRQC ECLAVLMSSS VPNREPSAIT AAGRRSMLKL AQRMTDNFCA GVCASSARKW  540
SRLRNMGSIS EEVRVMTRQS MDDPGEPPGV VLSAATSVWL PISPQRLFDF LRDENLRCQW  600
DILSNGGPMR EMAHIAKGLQ DQGNAVSLLC ANALNTDQSS MLILQETCTD ASGSMVVYAP  660
VDVPAMHHVM NGGDSTYVAL LPSGFAVMPD GGAVGSLLTV AFQILVNSLP TAKLTVESVE  720
TVSNLISCTV QKIKVALQGE S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008799528.10.0PREDICTED: homeobox-leucine zipper protein ROC5 isoform X1
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA5BH090.0A5BH09_VITVI; Putative uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein